General Information

  • ID:  hor004755
  • Uniprot ID:  Q1G3V9
  • Protein name:  EPIDERMAL PATTERNING FACTOR-like protein 8
  • Gene name:  EPFL8
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  Plant cysteine rich small secretory peptide family, Epidermal patterning factor subfamily
  • Source:  Plant
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003674 molecular_function
  • GO BP:  GO:0010052 guard cell differentiation; GO:0010374 stomatal complex development
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MGSEPPVCATKCRNCKPCLPYLFDIRGAHDDDDDSEPYYPVKWICRCRDRVFEP
  • Length:  54(46-99)
  • Propeptide:  MDSSRKYKRCGFGAALFVANIFFSLLSLHCISGAHGHQQRMKESVMGSEPPVCATKCRNCKPCLPYLFDIRGAHDDDDDSEPYYPVKWICRCRDRVFEP
  • Signal peptide:  MDSSRKYKRCGFGAALFVANIFFSLLSLHCISGAH
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Controls stomatal patterning.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  8-45; 12-18; 15-47
  • Structure ID:  AF-Q1G3V9-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004755_AF2.pdbhor004755_ESM.pdb

Physical Information

Mass: 725472 Formula: C274H414N76O82S7
Absent amino acids: Q Common amino acids: DPC
pI: 4.93 Basic residues: 9
Polar residues: 15 Hydrophobic residues: 12
Hydrophobicity: -73.52 Boman Index: -13819
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 48.7
Instability Index: 4821.67 Extinction Coefficient cystines: 10345
Absorbance 280nm: 195.19

Literature

  • PubMed ID:  22027592
  • Title:  The NMR Structure of Stomagen Reveals the Basis of Stomatal Density Regulation by Plant Peptide Hormones